RBM38 Antikörper (Middle Region)

Produktnummer ABIN633488

Produktdetails anti-RBM38 Antikörper

Target: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM38 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBM38 antibody was raised against the middle region of RBM38

Aufreinigung: Affinity purified

Immunogen: RBM38 antibody was raised using the middle region of RBM38 corresponding to a region with amino acids QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM38 Blocking Peptide, catalog no. 33R-7794, is also available for use as a blocking control in assays to test for specificity of this RBM38 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM38 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM38

Target: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Andere Bezeichnung: RBM38 (RBM38 Produkte)

Hintergrund: RBM38 is a probable RNA-binding protein.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development