RBM38 Antikörper (N-Term)

Produktnummer ABIN633487

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch RBM38 in IHC und WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für RBM38 Antikörper (N-Term) (ABIN633487)

Target: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM38 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Produktdetails anti-RBM38 Antikörper

Bindungsspezifität: N-Term

Spezifität: RBM38 antibody was raised against the N terminal of RBM38

Aufreinigung: Affinity purified

Immunogen: RBM38 antibody was raised using the N terminal of RBM38 corresponding to a region with amino acids LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM38 Blocking Peptide, (ABIN5615790), is also available for use as a blocking control in assays to test for specificity of this RBM38 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM38 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM38

Target: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Andere Bezeichnung: RBM38

Hintergrund: RBM38 is a probable RNA-binding protein.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development