PAIP1 Antikörper
-
- Target Alle PAIP1 Antikörper anzeigen
- PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PAIP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS
- Top Product
- Discover our top product PAIP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PAIP1 Blocking Peptide, catalog no. 33R-6406, is also available for use as a blocking control in assays to test for specificity of this PAIP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAIP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))
- Andere Bezeichnung
- PAIP1 (PAIP1 Produkte)
- Synonyme
- fb53g01 antikoerper, zgc:91954 antikoerper, wu:fb53g01 antikoerper, poly(A) binding protein interacting protein 1 antikoerper, polyadenylate binding protein-interacting protein 1 antikoerper, poly(A) binding protein interacting protein 1 S homeolog antikoerper, PAIP1 antikoerper, paip1 antikoerper, Paip1 antikoerper, paip1.S antikoerper
- Hintergrund
- PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.
- Molekulargewicht
- 46 kDa (MW of target protein)
-