PAIP1 Antikörper

Produktnummer ABIN633480

Dieses Anti-PAIP1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PAIP1 in WB. Geeignet für Human und Maus.

Kurzübersicht für PAIP1 Antikörper (ABIN633480)

Target: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAIP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PAIP1 Antikörper

Aufreinigung: Affinity purified

Immunogen: PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAIP1 Blocking Peptide, (ABIN5615194), is also available for use as a blocking control in assays to test for specificity of this PAIP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAIP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAIP1

Target: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Andere Bezeichnung: PAIP1

Hintergrund: PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.

Molekulargewicht: 46 kDa (MW of target protein)