FOXRED1 Antikörper (N-Term)

Produktnummer ABIN633466

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FOXRED1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für FOXRED1 Antikörper (N-Term) (ABIN633466)

Target: FOXRED1 (FAD-Dependent Oxidoreductase Domain Containing 1 (FOXRED1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FOXRED1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FOXRED1 Antikörper

Bindungsspezifität: N-Term

Spezifität: FOXRED1 antibody was raised against the N terminal of FOXRED1

Aufreinigung: Affinity purified

Immunogen: FOXRED1 antibody was raised using the N terminal of FOXRED1 corresponding to a region with amino acids SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FOXRED1 Blocking Peptide, (ABIN5613640), is also available for use as a blocking control in assays to test for specificity of this FOXRED1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOXRED1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FOXRED1

Target: FOXRED1 (FAD-Dependent Oxidoreductase Domain Containing 1 (FOXRED1))

Andere Bezeichnung: FOXRED1

Hintergrund: The FOXRED1 protein contains a FAD-dependent oxidoreductase domain. The encoded protein is localized to the mitochondria and may function as a chaperone protein required for the function of mitochondrial complex I. Mutations in this gene are associated with mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene.

Molekulargewicht: 54 kDa (MW of target protein)