SSB Antikörper

Produktnummer ABIN633464

Der Kaninchen Polyklonal Anti-SSB-Antikörper wurde für WB und IHC validiert. Er ist geeignet, SSB in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für SSB Antikörper (ABIN633464)

Target: SSB (Sjogren Syndrome Antigen B (SSB))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SSB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SSB Antikörper

Aufreinigung: Affinity purified

Immunogen: SSB antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SSB Blocking Peptide, (ABIN939535), is also available for use as a blocking control in assays to test for specificity of this SSB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SSB

Target: SSB (Sjogren Syndrome Antigen B (SSB))

Andere Bezeichnung: SSB

Hintergrund: SSB is involved in diverse aspects of RNA metabolism, including binding and protecting 3-prime UUU(OH) elements of newly RNA polymerase III-transcribed RNA, processing 5-prime and 3-prime ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. SSB protein was originally defined by its reactivity with autoantibodies from patients with Sjogren syndrome and systemic lupus erythematosus.

Molekulargewicht: 45 kDa (MW of target protein)