EIF2S1 Antikörper (N-Term)
-
- Target Alle EIF2S1 Antikörper anzeigen
- EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Drosophila melanogaster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF2S1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EIF2 S1 antibody was raised against the N terminal of EIF2 1
- Aufreinigung
- Affinity purified
- Immunogen
- EIF2 S1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
- Top Product
- Discover our top product EIF2S1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF2S1 Blocking Peptide, catalog no. 33R-9903, is also available for use as a blocking control in assays to test for specificity of this EIF2S1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))
- Andere Bezeichnung
- EIF2S1 (EIF2S1 Produkte)
- Hintergrund
- The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, ER-Nucleus Signaling, Hepatitis C
-