RPS7 Antikörper (N-Term)

Produktnummer ABIN633403

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RPS7 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RPS7 Antikörper (N-Term) (ABIN633403)

Target: RPS7 (Ribosomal Protein S7 (RPS7))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPS7 Antikörper

Bindungsspezifität: N-Term

Spezifität: RPS7 antibody was raised against the N terminal of RPS7

Aufreinigung: Affinity purified

Immunogen: RPS7 antibody was raised using the N terminal of RPS7 corresponding to a region with amino acids MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS7 Blocking Peptide, (ABIN5615953), is also available for use as a blocking control in assays to test for specificity of this RPS7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS7

Target: RPS7 (Ribosomal Protein S7 (RPS7))

Andere Bezeichnung: RPS7

Hintergrund: RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Tube Formation