U2AF1 Antikörper (N-Term)

Produktnummer ABIN633390

Der Kaninchen Polyklonal anti-U2AF1 Antikörper (ABIN633390) detektiert spezifisch U2AF1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte und Drosophila melanogaster.

Kurzübersicht für U2AF1 Antikörper (N-Term) (ABIN633390)

Target: U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1 (U2AF1))

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser U2AF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-U2AF1 Antikörper

Bindungsspezifität: N-Term

Spezifität: U2 AF1 antibody was raised against the N terminal of U2 F1

Aufreinigung: Affinity purified

Immunogen: U2 AF1 antibody was raised using the N terminal of U2 F1 corresponding to a region with amino acids MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

U2AF1 Blocking Peptide, (ABIN5616855), is also available for use as a blocking control in assays to test for specificity of this U2AF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of U0 F1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu U2AF1

Target: U2AF1 (U2 Small Nuclear RNA Auxiliary Factor 1 (U2AF1))

Andere Bezeichnung: U2AF1

Hintergrund: This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site.

Molekulargewicht: 28 kDa (MW of target protein)