DDX42 Antikörper

Produktnummer ABIN633362

Produktdetails anti-DDX42 Antikörper

Target: DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DDX42 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX42 Blocking Peptide, catalog no. 33R-7187, is also available for use as a blocking control in assays to test for specificity of this DDX42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX42

Target: DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))

Andere Bezeichnung: DDX42 (DDX42 Produkte)

Synonyme: im:7148194 antikoerper, si:dkey-15n1.10 antikoerper, zgc:111815 antikoerper, DDX42P antikoerper, RHELP antikoerper, RNAHP antikoerper, SF3b125 antikoerper, 1810047H21Rik antikoerper, AW319508 antikoerper, AW556242 antikoerper, B430002H05Rik antikoerper, DEAD (Asp-Glu-Ala-Asp) box helicase 42 antikoerper, DEAD-box helicase 42 antikoerper, DEAD-box helicase 42 L homeolog antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 42 antikoerper, ddx42 antikoerper, DDX42 antikoerper, Ddx42 antikoerper, ddx42.L antikoerper

Hintergrund: DDX42 is a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.

Molekulargewicht: 103 kDa (MW of target protein)