DDX42 Antikörper

Produktnummer ABIN633362

Der Kaninchen Polyklonal Anti-DDX42-Antikörper wurde für WB validiert. Er ist geeignet, DDX42 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für DDX42 Antikörper (ABIN633362)

Target: DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDX42 Antikörper

Aufreinigung: Affinity purified

Immunogen: DDX42 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX42 Blocking Peptide, (ABIN5613163), is also available for use as a blocking control in assays to test for specificity of this DDX42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX42

Target: DDX42 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 42 (DDX42))

Andere Bezeichnung: DDX42

Hintergrund: DDX42 is a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.

Molekulargewicht: 103 kDa (MW of target protein)