IFIH1 Antikörper (Middle Region)

Produktnummer ABIN633360

Der Kaninchen Polyklonal anti-IFIH1 Antikörper (ABIN633360) detektiert spezifisch IFIH1 in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für IFIH1 Antikörper (Middle Region) (ABIN633360)

Target: IFIH1 (Interferon Induced with Helicase C Domain 1 (IFIH1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFIH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-IFIH1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: IFIH1 antibody was raised against the middle region of IFIH1

Aufreinigung: Affinity purified

Immunogen: IFIH1 antibody was raised using the middle region of IFIH1 corresponding to a region with amino acids QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFIH1 Blocking Peptide, (ABIN5614142), is also available for use as a blocking control in assays to test for specificity of this IFIH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFIH1

Target: IFIH1 (Interferon Induced with Helicase C Domain 1 (IFIH1))

Andere Bezeichnung: IFIH1

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. IFIH1 is a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents, treatment with either agent alone only achieves reversible differentiation.

Molekulargewicht: 117 kDa (MW of target protein)

Pathways: Activation of Innate immune Response