A2BP1 Antikörper (Middle Region)
-
- Target Alle A2BP1 Antikörper anzeigen
- A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser A2BP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- A2 BP1 antibody was raised against the middle region of A2 P1
- Aufreinigung
- Affinity purified
- Immunogen
- A2 BP1 antibody was raised using the middle region of A2 P1 corresponding to a region with amino acids TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP
- Top Product
- Discover our top product A2BP1 Primärantikörper
-
anti-Ataxin 2-Binding Protein 1 (A2BP1) (AA 1-130) antibody
A2BP1 Reaktivität: Human IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Ataxin 2-Binding Protein 1 (A2BP1) (AA 81-130) antibodyA2BP1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Hund, Schwein, Kaninchen, Affe, Fledermaus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Ataxin 2-Binding Protein 1 (A2BP1) (N-Term) antibodyA2BP1 Reaktivität: Human WB, IHC Wirt: Maus Monoclonal 1G10 unconjugated
anti-Ataxin 2-Binding Protein 1 (A2BP1) (AA 149-399) antibodyA2BP1 Reaktivität: Ratte WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Ataxin 2-Binding Protein 1 (A2BP1) (N-Term) antibodyA2BP1 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Ataxin 2-Binding Protein 1 (A2BP1) (AA 1-130) antibodyA2BP1 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ataxin 2-Binding Protein 1 (A2BP1) (AA 51-100) antibodyA2BP1 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ataxin 2-Binding Protein 1 (A2BP1) (C-Term) antibodyA2BP1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Hund, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Ataxin 2-Binding Protein 1 (A2BP1) (N-Term) antibodyA2BP1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Hund, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
A2BP1 Blocking Peptide, catalog no. 33R-8963, is also available for use as a blocking control in assays to test for specificity of this A2BP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 P1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))
- Andere Bezeichnung
- A2BP1 (A2BP1 Produkte)
- Synonyme
- A2BP1 antikoerper, fox1 antikoerper, a2bp1 antikoerper, zgc:103635 antikoerper, 2BP1 antikoerper, FOX-1 antikoerper, FOX1 antikoerper, HRNBP1 antikoerper, A2bp antikoerper, A2bp1 antikoerper, Hrnbp1 antikoerper, fox-1 antikoerper, RNA binding protein, fox-1 homolog 1 antikoerper, RNA binding fox-1 homolog 1 antikoerper, multicopper ferroxidase antikoerper, RNA binding protein, fox-1 homolog (C. elegans) 1 antikoerper, RBFOX1 antikoerper, rbfox1 antikoerper, FOX1 antikoerper, Rbfox1 antikoerper
- Hintergrund
- Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2).
- Molekulargewicht
- 42 kDa (MW of target protein)
-
