LSM6 Antikörper

Produktnummer ABIN633347

Produktdetails anti-LSM6 Antikörper

Target: LSM6 (LSM6 Homolog, U6 Small Nuclear RNA Associated (LSM6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LSM6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LSM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LSM6 Blocking Peptide, catalog no. 33R-6468, is also available for use as a blocking control in assays to test for specificity of this LSM6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LSM6

Target: LSM6 (LSM6 Homolog, U6 Small Nuclear RNA Associated (LSM6))

Andere Bezeichnung: LSM6 (LSM6 Produkte)

Synonyme: zgc:92379 antikoerper, YDR378C antikoerper, 1500031N17Rik antikoerper, 2410088K19Rik antikoerper, AI747288 antikoerper, RGD1561937 antikoerper, LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated S homeolog antikoerper, LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated antikoerper, lsm6.S antikoerper, lsm6 antikoerper, LSM6 antikoerper, Lsm6 antikoerper

Hintergrund: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Molekulargewicht: 9 kDa (MW of target protein)