THOC1 Antikörper (C-Term)

Produktnummer ABIN633337

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch THOC1 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für THOC1 Antikörper (C-Term) (ABIN633337)

Target: THOC1 (THO Complex 1 (THOC1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser THOC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-THOC1 Antikörper

Bindungsspezifität: C-Term

Spezifität: THOC1 antibody was raised against the C terminal of THOC1

Aufreinigung: Affinity purified

Immunogen: THOC1 antibody was raised using the C terminal of THOC1 corresponding to a region with amino acids TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

THOC1 Blocking Peptide, (ABIN5616588), is also available for use as a blocking control in assays to test for specificity of this THOC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu THOC1

Target: THOC1 (THO Complex 1 (THOC1))

Andere Bezeichnung: THOC1

Hintergrund: THOC1 is part of the TREX (transcription/export) complex, which includes TEX1, THO2, ALY, and UAP56.

Molekulargewicht: 76 kDa (MW of target protein)