HDLBP Antikörper

Produktnummer ABIN633335

Der Kaninchen Polyklonal anti-HDLBP Antikörper wird verwendet zum Nachweis von HDLBP in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für HDLBP Antikörper (ABIN633335)

Target: HDLBP (High Density Lipoprotein Binding Protein (HDLBP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HDLBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HDLBP Antikörper

Aufreinigung: Affinity purified

Immunogen: HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HDLBP Blocking Peptide, (ABIN5613978), is also available for use as a blocking control in assays to test for specificity of this HDLBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDLBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HDLBP

Target: HDLBP (High Density Lipoprotein Binding Protein (HDLBP))

Andere Bezeichnung: HDLBP

Hintergrund: HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.

Molekulargewicht: 141 kDa (MW of target protein)