HDLBP Antikörper
-
- Target Alle HDLBP Antikörper anzeigen
- HDLBP (High Density Lipoprotein Binding Protein (HDLBP))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HDLBP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV
- Top Product
- Discover our top product HDLBP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HDLBP Blocking Peptide, catalog no. 33R-8017, is also available for use as a blocking control in assays to test for specificity of this HDLBP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDLBP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HDLBP (High Density Lipoprotein Binding Protein (HDLBP))
- Andere Bezeichnung
- HDLBP (HDLBP Produkte)
- Synonyme
- HBP antikoerper, PRO2900 antikoerper, VGL antikoerper, 1110005P14Rik antikoerper, AA960365 antikoerper, AI118566 antikoerper, D1Ertd101e antikoerper, HDLBP antikoerper, vigilin antikoerper, cb591 antikoerper, cb811 antikoerper, hdlbp antikoerper, wu:fb36d01 antikoerper, wu:fb94h08 antikoerper, wu:fc23d06 antikoerper, wu:fc75h07 antikoerper, high density lipoprotein binding protein antikoerper, high density lipoprotein (HDL) binding protein antikoerper, vigilin antikoerper, high density lipoprotein binding protein (vigilin) S homeolog antikoerper, high density lipoprotein binding protein a antikoerper, HDLBP antikoerper, Hdlbp antikoerper, hdlbp.S antikoerper, hdlbpa antikoerper
- Hintergrund
- HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.
- Molekulargewicht
- 141 kDa (MW of target protein)
-