THO Complex 3 Antikörper (Middle Region)
-
- Target Alle THO Complex 3 (THOC3) Antikörper anzeigen
- THO Complex 3 (THOC3)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser THO Complex 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- THOC3 antibody was raised against the middle region of THOC3
- Aufreinigung
- Affinity purified
- Immunogen
- THOC3 antibody was raised using the middle region of THOC3 corresponding to a region with amino acids LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND
- Top Product
- Discover our top product THOC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
THOC3 Blocking Peptide, catalog no. 33R-5554, is also available for use as a blocking control in assays to test for specificity of this THOC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- THO Complex 3 (THOC3)
- Andere Bezeichnung
- THOC3 (THOC3 Produkte)
- Synonyme
- THOC3 antikoerper, zgc:100815 antikoerper, THO3 antikoerper, hTREX45 antikoerper, 2410044K02Rik antikoerper, AL033344 antikoerper, THO complex 3 antikoerper, THO complex subunit 3 antikoerper, THOC3 antikoerper, thoc3 antikoerper, LOC100400596 antikoerper, Thoc3 antikoerper
- Hintergrund
- THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.
- Molekulargewicht
- 39 kDa (MW of target protein)
-