THO Complex 3 Antikörper (Middle Region)

Produktnummer ABIN630029

Produktdetails anti-THO Complex 3 Antikörper

Target: THO Complex 3 (THOC3)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser THO Complex 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: THOC3 antibody was raised against the middle region of THOC3

Aufreinigung: Purified

Immunogen: THOC3 antibody was raised using the middle region of THOC3 corresponding to a region with amino acids PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

THOC3 Blocking Peptide, catalog no. 33R-7013, is also available for use as a blocking control in assays to test for specificity of this THOC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu THO Complex 3

Target: THO Complex 3 (THOC3)

Andere Bezeichnung: THOC3 (THOC3 Produkte)

Synonyme: THOC3 antikoerper, zgc:100815 antikoerper, THO3 antikoerper, hTREX45 antikoerper, 2410044K02Rik antikoerper, AL033344 antikoerper, THO complex 3 antikoerper, THO complex subunit 3 antikoerper, THOC3 antikoerper, thoc3 antikoerper, LOC100400596 antikoerper, Thoc3 antikoerper

Hintergrund: THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.

Molekulargewicht: 39 kDa (MW of target protein)