EIF4H Antikörper (C-Term)

Produktnummer ABIN633301

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch EIF4H in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für EIF4H Antikörper (C-Term) (ABIN633301)

Target: EIF4H (Eukaryotic Translation Initiation Factor 4H (EIF4H))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4H Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EIF4H Antikörper

Bindungsspezifität: C-Term

Spezifität: EIF4 H antibody was raised against the C terminal of EIF4

Aufreinigung: Affinity purified

Immunogen: EIF4 H antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF4H Blocking Peptide, (ABIN5613350), is also available for use as a blocking control in assays to test for specificity of this EIF4H antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4H

Target: EIF4H (Eukaryotic Translation Initiation Factor 4H (EIF4H))

Andere Bezeichnung: EIF4H

Hintergrund: EIF4H is one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom