SNRPA1 Antikörper (N-Term)

Produktnummer ABIN633289

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SNRPA1 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für SNRPA1 Antikörper (N-Term) (ABIN633289)

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRPA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SNRPA1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SNRPA1 antibody was raised against the N terminal of SNRPA1

Aufreinigung: Affinity purified

Immunogen: SNRPA1 antibody was raised using the N terminal of SNRPA1 corresponding to a region with amino acids VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRPA1 Blocking Peptide, catalog no. 33R-9630, is also available for use as a blocking control in assays to test for specificity of this SNRPA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRPA1

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Andere Bezeichnung: SNRPA1

Hintergrund: SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.

Molekulargewicht: 28 kDa (MW of target protein)