SERBP1 Antikörper (Middle Region)

Produktnummer ABIN633269

Der Kaninchen Polyklonal Anti-SERBP1-Antikörper wurde für WB validiert. Er ist geeignet, SERBP1 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für SERBP1 Antikörper (Middle Region) (ABIN633269)

Target: SERBP1 (SERPINE1 mRNA Binding Protein 1 (SERBP1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SERBP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SERBP1 antibody was raised against the middle region of SERBP1

Aufreinigung: Affinity purified

Immunogen: SERBP1 antibody was raised using the middle region of SERBP1 corresponding to a region with amino acids SYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDE

Anwendungsinformationen

Applikationshinweise: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERBP1 Blocking Peptide, (ABIN5616054), is also available for use as a blocking control in assays to test for specificity of this SERBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERBP1

Target: SERBP1 (SERPINE1 mRNA Binding Protein 1 (SERBP1))

Andere Bezeichnung: SERBP1

Hintergrund: SERBP1 may play a role in the regulation of mRNA stability. It binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.

Molekulargewicht: 45 kDa (MW of target protein)