SERBP1 Antikörper (C-Term)

Produktnummer ABIN633268

Produktdetails anti-SERBP1 Antikörper

Target: SERBP1 (SERPINE1 mRNA Binding Protein 1 (SERBP1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SERBP1 antibody was raised against the C terminal of SERBP1

Aufreinigung: Affinity purified

Immunogen: SERBP1 antibody was raised using the C terminal of SERBP1 corresponding to a region with amino acids DRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERBP1 Blocking Peptide, catalog no. 33R-2138, is also available for use as a blocking control in assays to test for specificity of this SERBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERBP1

Target: SERBP1 (SERPINE1 mRNA Binding Protein 1 (SERBP1))

Andere Bezeichnung: SERBP1 (SERBP1 Produkte)

Synonyme: CHD3IP antikoerper, HABP4L antikoerper, PAI-RBP1 antikoerper, PAIRBP1 antikoerper, 1200009K13Rik antikoerper, 9330147J08Rik antikoerper, AL022786 antikoerper, Pairbp1 antikoerper, Pai-Rbp1 antikoerper, Rda288 antikoerper, cgi-55 antikoerper, chd3ip antikoerper, habp4l antikoerper, pai-rbp1 antikoerper, pairbp1 antikoerper, rda288 antikoerper, hm:zeh0245 antikoerper, serbp1 antikoerper, wu:fa12d05 antikoerper, wu:fb36e07 antikoerper, wu:fc16f12 antikoerper, wu:fj13e12 antikoerper, zgc:55489 antikoerper, SERPINE1 mRNA binding protein 1 antikoerper, serpine1 mRNA binding protein 1 antikoerper, Serpine1 mRNA binding protein 1 antikoerper, SERPINE1 mRNA binding protein 1 L homeolog antikoerper, SERPINE1 mRNA binding protein 1a antikoerper, SERBP1 antikoerper, Serbp1 antikoerper, serbp1.L antikoerper, serbp1a antikoerper

Hintergrund: SERBP1 may play a role in the regulation of mRNA stability. It binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.

Molekulargewicht: 45 kDa (MW of target protein)