EIF4E Antikörper (C-Term)

Produktnummer ABIN633255

Produktdetails anti-EIF4E Antikörper

Target: EIF4E (Eukaryotic Translation Initiation Factor 4E (EIF4E))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4E Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF4 E antibody was raised against the C terminal of EIF4

Aufreinigung: Affinity purified

Immunogen: EIF4 E antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF4E Blocking Peptide, catalog no. 33R-9028, is also available for use as a blocking control in assays to test for specificity of this EIF4E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4E

Target: EIF4E (Eukaryotic Translation Initiation Factor 4E (EIF4E))

Andere Bezeichnung: EIF4E (EIF4E Produkte)

Synonyme: AUTS19 antikoerper, CBP antikoerper, EIF4E1 antikoerper, EIF4EL1 antikoerper, EIF4F antikoerper, eif4e-1 antikoerper, zgc:86680 antikoerper, EG668879 antikoerper, Eif4e-ps antikoerper, If4e antikoerper, eIF-4E antikoerper, 0260/09 antikoerper, 0587/11 antikoerper, 0589/11 antikoerper, 0919/12 antikoerper, 1004/13 antikoerper, 2 antikoerper, 7238 antikoerper, CG4035 antikoerper, CT13384 antikoerper, CT39424 antikoerper, CT39426 antikoerper, D-eIF4E antikoerper, Dmel\\CG4035 antikoerper, Eif4E antikoerper, Eif4e antikoerper, IF4E antikoerper, dEif4e antikoerper, deIF-4E antikoerper, deIF4E antikoerper, eIF 4E antikoerper, eIF-4E1 antikoerper, eIF-4E2 antikoerper, eIF-4EII antikoerper, eIF-4e antikoerper, eIF4E antikoerper, eIF4E-1 antikoerper, eIF4E-1/2 antikoerper, eIF4E-2 antikoerper, eIF4E1 antikoerper, eIF4EI antikoerper, eIF4e antikoerper, eif-4E antikoerper, eif-4e antikoerper, eif4e antikoerper, l(3)07238 antikoerper, l(3)67Af antikoerper, l(3)S025007 antikoerper, l(3)S026009 antikoerper, l(3)S058711 antikoerper, l(3)S091912 antikoerper, cbp antikoerper, eif4f antikoerper, eif4e1 antikoerper, eif4el1 antikoerper, EIF-4E antikoerper, zgc:101581 antikoerper, eukaryotic translation initiation factor 4E antikoerper, eukaryotic translation initiation factor 4ea antikoerper, Eukaryotic initiation factor 4E antikoerper, eucaryotic initiation factor 6 antikoerper, eukaryotic translation initiation factor 4E L homeolog antikoerper, eukaryotic translation initiation factor 4E family member 1B S homeolog antikoerper, translation initiation factor eIF4E antikoerper, eukaryotic translation initiation factor 4eb antikoerper, EIF4E antikoerper, eif4ea antikoerper, Eif4e antikoerper, eIF-4E antikoerper, eif6 antikoerper, eif4e antikoerper, eif4e.L antikoerper, eif4e1b.S antikoerper, LOC100533326 antikoerper, eif4eb antikoerper

Hintergrund: All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: BCR Signaling