EIF4E Antikörper (C-Term)

Produktnummer ABIN633255

Dieses Anti-EIF4E-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von EIF4E in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für EIF4E Antikörper (C-Term) (ABIN633255)

Target: EIF4E (Eukaryotic Translation Initiation Factor 4E (EIF4E))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4E Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EIF4E Antikörper

Bindungsspezifität: C-Term

Spezifität: EIF4 E antibody was raised against the C terminal of EIF4

Aufreinigung: Affinity purified

Immunogen: EIF4 E antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF4E Blocking Peptide, (ABIN5613341), is also available for use as a blocking control in assays to test for specificity of this EIF4E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4E

Target: EIF4E (Eukaryotic Translation Initiation Factor 4E (EIF4E))

Andere Bezeichnung: EIF4E

Hintergrund: All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: BCR Signaling