PABP Antikörper

Produktnummer ABIN633226

Produktdetails anti-PABP Antikörper

Target: PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PABP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PABPC1 Blocking Peptide, catalog no. 33R-5379, is also available for use as a blocking control in assays to test for specificity of this PABPC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PABP

Target: PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))

Andere Bezeichnung: PABPC1 (PABPC1 Produkte)

Synonyme: PAB1 antikoerper, PABP antikoerper, PABP1 antikoerper, PABPC2 antikoerper, PABPL1 antikoerper, Pabp1 antikoerper, PabpI antikoerper, Pabpl1 antikoerper, ePAB antikoerper, Pabp antikoerper, pab1 antikoerper, pabp antikoerper, pabp1 antikoerper, pabpc1 antikoerper, pabpc2 antikoerper, PABPC1 antikoerper, wu:fb16a02 antikoerper, wu:fi19b08 antikoerper, wu:fj12d09 antikoerper, wu:fj61f06 antikoerper, zgc:109879 antikoerper, zgc:77608 antikoerper, poly(A) binding protein cytoplasmic 1 antikoerper, poly(A) binding protein, cytoplasmic 1 antikoerper, poly(A) binding protein, cytoplasmic 1 S homeolog antikoerper, poly(A) binding protein cytoplasmic 1 like antikoerper, poly(A) binding protein, cytoplasmic 1 L homeolog antikoerper, poly(A) binding protein, cytoplasmic 1a antikoerper, poly A binding protein, cytoplasmic 1 b antikoerper, PABPC1 antikoerper, Pabpc1 antikoerper, pabpc1.S antikoerper, pabpc1 antikoerper, PABPC1L antikoerper, pabpc1.L antikoerper, pabpc1a antikoerper, pabpc1b antikoerper

Hintergrund: The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation.

Molekulargewicht: 71 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom