PABP Antikörper
-
- Target Alle PABP (PABPC1) Antikörper anzeigen
- PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PABP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
- Top Product
- Discover our top product PABPC1 Primärantikörper
-
anti-Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) (AA 350-450) antibody
PABPC1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) antibodyPABPC1 Reaktivität: Human, Kaninchen, Huhn, Xenopus laevis, Hamster WB, ELISA, IF, IP, FACS, ICC Wirt: Maus Monoclonal 10E10 unconjugated
anti-Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) (meArg455), (meArg460) antibodyPABPC1 Reaktivität: Maus, Ratte WB, ELISA, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) (AA 1-636) antibodyPABPC1 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) (AA 101-200) antibodyPABPC1 Reaktivität: Human, Maus, Ratte WB, ELISA, IF (cc), IF (p), IHC (p), FACS, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) (AA 250-279) antibodyPABPC1 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB20873 unconjugated
anti-Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) (AA 431-480) antibodyPABPC1 Reaktivität: Human, Maus, Ratte, Kaninchen, Huhn, Rind (Kuh), Hund, Meerschweinchen, Pferd, Schaf, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) (Middle Region) antibodyPABPC1 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hund, Meerschweinchen, Pferd, Schaf WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PABPC1 Blocking Peptide, catalog no. 33R-5379, is also available for use as a blocking control in assays to test for specificity of this PABPC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))
- Andere Bezeichnung
- PABPC1 (PABPC1 Produkte)
- Hintergrund
- The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation.
- Molekulargewicht
- 71 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-
