PABP Antikörper

Produktnummer ABIN633226

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PABP in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für PABP Antikörper (ABIN633226)

Target: PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PABP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PABP Antikörper

Aufreinigung: Affinity purified

Immunogen: PABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PABPC1 Blocking Peptide, (ABIN5615183), is also available for use as a blocking control in assays to test for specificity of this PABPC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PABP

Target: PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))

Andere Bezeichnung: PABPC1

Hintergrund: The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation.

Molekulargewicht: 71 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom