AARS Antikörper (C-Term)

Produktnummer ABIN633213

Dieses Anti-AARS-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von AARS in WB. Geeignet für Human und Maus.

Kurzübersicht für AARS Antikörper (C-Term) (ABIN633213)

Target: AARS (Alanyl tRNA Synthetase (AARS))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AARS Antikörper

Bindungsspezifität: C-Term

Spezifität: AARS antibody was raised against the C terminal of AARS

Aufreinigung: Affinity purified

Immunogen: AARS antibody was raised using the C terminal of AARS corresponding to a region with amino acids VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AARS Blocking Peptide, (ABIN5611847), is also available for use as a blocking control in assays to test for specificity of this AARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AARS

Target: AARS (Alanyl tRNA Synthetase (AARS))

Andere Bezeichnung: AARS

Hintergrund: The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure.

Molekulargewicht: 107 kDa (MW of target protein)