RPL5 Antikörper (N-Term)

Produktnummer ABIN633202

Produktdetails anti-RPL5 Antikörper

Target: RPL5 (Ribosomal Protein L5 (RPL5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, Arabidopsis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPL5 antibody was raised against the N terminal of RPL5

Aufreinigung: Affinity purified

Immunogen: RPL5 antibody was raised using the N terminal of RPL5 corresponding to a region with amino acids RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL5 Blocking Peptide, catalog no. 33R-8055, is also available for use as a blocking control in assays to test for specificity of this RPL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL5

Target: RPL5 (Ribosomal Protein L5 (RPL5))

Andere Bezeichnung: RPL5 (RPL5 Produkte)

Hintergrund: RPL5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.

Molekulargewicht: 34 kDa (MW of target protein)