XPO1 Antikörper

Produktnummer ABIN633201

Produktdetails anti-XPO1 Antikörper

Target: XPO1 (Exportin 1 (XPO1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XPO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XPO1 Blocking Peptide, catalog no. 33R-4086, is also available for use as a blocking control in assays to test for specificity of this XPO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu XPO1

Target: XPO1 (Exportin 1 (XPO1))

Andere Bezeichnung: XPO1 (XPO1 Produkte)

Synonyme: CG13387 antikoerper, CRM1 antikoerper, Crm1 antikoerper, DCRM1 antikoerper, Dmel\\CG13387 antikoerper, Emb antikoerper, XPO-1 antikoerper, XPO1 antikoerper, Xpo1 antikoerper, crm1 antikoerper, dCRM1 antikoerper, l(2)k16715 antikoerper, 18.m06600 antikoerper, DDBDRAFT_0183812 antikoerper, DDBDRAFT_0234066 antikoerper, DDB_0183812 antikoerper, DDB_0234066 antikoerper, exportin-1 antikoerper, LOC100220104 antikoerper, emb antikoerper, exp1 antikoerper, Xpo antikoerper, AA420417 antikoerper, Exp1 antikoerper, embargoed antikoerper, exportin 1 antikoerper, putative exportin 1 antikoerper, chromosome region maintenance protein 1 antikoerper, exportin-1 antikoerper, exportin 1 (CRM1 homolog, yeast) antikoerper, exportin 1 S homeolog antikoerper, emb antikoerper, cgd3_3060 antikoerper, Tc00.1047053511725.150 antikoerper, Tb11.01.5940 antikoerper, BBOV_II007220 antikoerper, LMJF_32_1100 antikoerper, xpo1 antikoerper, Xpo1 antikoerper, XPO1 antikoerper, LOC100165622 antikoerper, LOC100633509 antikoerper, xpo1.S antikoerper

Hintergrund: XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is also involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1.

Molekulargewicht: 123 kDa (MW of target protein)

Pathways: M Phase