TMPRSS6 Antikörper (N-Term)
-
- Target Alle TMPRSS6 Antikörper anzeigen
- TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMPRSS6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMPRSS6 antibody was raised against the N terminal of TMPRSS6
- Aufreinigung
- Affinity purified
- Immunogen
- TMPRSS6 antibody was raised using the N terminal of TMPRSS6 corresponding to a region with amino acids LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
- Top Product
- Discover our top product TMPRSS6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMPRSS6 Blocking Peptide, catalog no. 33R-5200, is also available for use as a blocking control in assays to test for specificity of this TMPRSS6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))
- Andere Bezeichnung
- TMPRSS6 (TMPRSS6 Produkte)
- Synonyme
- IRIDA antikoerper, 1300008A22Rik antikoerper, transmembrane protease, serine 6 antikoerper, transmembrane serine protease 6 antikoerper, Tmprss6 antikoerper, TMPRSS6 antikoerper
- Hintergrund
- TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.
- Molekulargewicht
- 90 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-