TMPRSS6 Antikörper (N-Term)

Produktnummer ABIN633178

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TMPRSS6 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für TMPRSS6 Antikörper (N-Term) (ABIN633178)

Target: TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMPRSS6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMPRSS6 Antikörper

Bindungsspezifität: N-Term

Spezifität: TMPRSS6 antibody was raised against the N terminal of TMPRSS6

Aufreinigung: Affinity purified

Immunogen: TMPRSS6 antibody was raised using the N terminal of TMPRSS6 corresponding to a region with amino acids LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMPRSS6 Blocking Peptide, (ABIN5616699), is also available for use as a blocking control in assays to test for specificity of this TMPRSS6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMPRSS6

Target: TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))

Andere Bezeichnung: TMPRSS6

Hintergrund: TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.

Molekulargewicht: 90 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis