CRNN Antikörper (Middle Region)

Produktnummer ABIN633156

Produktdetails anti-CRNN Antikörper

Target: CRNN (Cornulin (CRNN))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRNN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Cornulin antibody was raised against the middle region of CRNN

Aufreinigung: Affinity purified

Immunogen: Cornulin antibody was raised using the middle region of CRNN corresponding to a region with amino acids GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cornulin Blocking Peptide, catalog no. 33R-3210, is also available for use as a blocking control in assays to test for specificity of this Cornulin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRNN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRNN

Target: CRNN (Cornulin (CRNN))

Andere Bezeichnung: Cornulin (CRNN Produkte)

Synonyme: C1orf10 antikoerper, DRC1 antikoerper, PDRC1 antikoerper, SEP53 antikoerper, RGD1311778 antikoerper, Gm1015 antikoerper, cornulin antikoerper, CRNN antikoerper, Crnn antikoerper, LOC100359146 antikoerper

Hintergrund: This gene encodes a member of the 'fused gene' family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.

Molekulargewicht: 52 kDa (MW of target protein)