SH3KBP1 Antikörper (N-Term)

Produktnummer ABIN633146

Produktdetails anti-SH3KBP1 Antikörper

Target: SH3KBP1 (SH3-Domain Kinase Binding Protein 1 (SH3KBP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH3KBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SH3 KBP1 antibody was raised against the N terminal of SH3 BP1

Aufreinigung: Affinity purified

Immunogen: SH3 KBP1 antibody was raised using the N terminal of SH3 BP1 corresponding to a region with amino acids TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH3KBP1 Blocking Peptide, catalog no. 33R-9090, is also available for use as a blocking control in assays to test for specificity of this SH3KBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 BP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH3KBP1

Target: SH3KBP1 (SH3-Domain Kinase Binding Protein 1 (SH3KBP1))

Andere Bezeichnung: SH3KBP1 (SH3KBP1 Produkte)

Synonyme: CD2BP3 antikoerper, CIN85 antikoerper, GIG10 antikoerper, HSB-1 antikoerper, HSB1 antikoerper, MIG18 antikoerper, 1200007H22Rik antikoerper, 1700125L08Rik antikoerper, 5830464D22Rik antikoerper, AI447724 antikoerper, IN85 antikoerper, Ruk antikoerper, Seta antikoerper, SH3 domain containing kinase binding protein 1 antikoerper, SH3-domain kinase binding protein 1 antikoerper, SH3 domain-containing kinase-binding protein 1 antikoerper, SH3KBP1 antikoerper, sh3kbp1 antikoerper, LOC100551401 antikoerper, Sh3kbp1 antikoerper

Hintergrund: This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, EGFR Downregulation