SH3KBP1 Antikörper (N-Term)

Produktnummer ABIN633146

Der Kaninchen Polyklonal Anti-SH3KBP1-Antikörper wurde für WB validiert. Er ist geeignet, SH3KBP1 in Proben von Human zu detektieren.

Kurzübersicht für SH3KBP1 Antikörper (N-Term) (ABIN633146)

Target: SH3KBP1 (SH3-Domain Kinase Binding Protein 1 (SH3KBP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SH3KBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SH3KBP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SH3 KBP1 antibody was raised against the N terminal of SH3 BP1

Aufreinigung: Affinity purified

Immunogen: SH3 KBP1 antibody was raised using the N terminal of SH3 BP1 corresponding to a region with amino acids TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SH3KBP1 Blocking Peptide, (ABIN5616128), is also available for use as a blocking control in assays to test for specificity of this SH3KBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 BP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SH3KBP1

Target: SH3KBP1 (SH3-Domain Kinase Binding Protein 1 (SH3KBP1))

Andere Bezeichnung: SH3KBP1

Hintergrund: This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, EGFR Downregulation