DYNC1I2 Antikörper (N-Term)

Produktnummer ABIN633070

Produktdetails anti-DYNC1I2 Antikörper

Target: DYNC1I2 (Dynein, Cytoplasmic 1, Intermediate Chain 2 (DYNC1I2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DYNC1I2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DYNC1 I2 antibody was raised against the N terminal of DYNC1 2

Aufreinigung: Affinity purified

Immunogen: DYNC1 I2 antibody was raised using the N terminal of DYNC1 2 corresponding to a region with amino acids VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DYNC1I2 Blocking Peptide, catalog no. 33R-9431, is also available for use as a blocking control in assays to test for specificity of this DYNC1I2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNC0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DYNC1I2

Target: DYNC1I2 (Dynein, Cytoplasmic 1, Intermediate Chain 2 (DYNC1I2))

Andere Bezeichnung: DYNC1I2 (DYNC1I2 Produkte)

Synonyme: dnci2 antikoerper, dncic1 antikoerper, ic2 antikoerper, dync1i2 antikoerper, im:7147021 antikoerper, zgc:153318 antikoerper, 3110079H08Rik antikoerper, AW554389 antikoerper, Dncic2 antikoerper, Dnci2 antikoerper, DNCI2 antikoerper, IC2 antikoerper, dynein, cytoplasmic 1, intermediate chain 2 antikoerper, dynein, cytoplasmic 1, intermediate chain 2 S homeolog antikoerper, dynein cytoplasmic 1 intermediate chain 2 antikoerper, dynein, cytoplasmic 1, intermediate chain 2a antikoerper, dync1i2 antikoerper, dync1i2.S antikoerper, DYNC1I2 antikoerper, dync1i2a antikoerper, Dync1i2 antikoerper

Hintergrund: DYNC1I2 acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. Involved in membrane-transport, such as Golgi apparatus, late endosomes and lysosomes.

Molekulargewicht: 71 kDa (MW of target protein)

Pathways: M Phase