CHMP4B Antikörper (Middle Region)

Produktnummer ABIN633066

Produktdetails anti-CHMP4B Antikörper

Target: CHMP4B (Charged Multivesicular Body Protein 4B (CHMP4B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHMP4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHMP4 B antibody was raised against the middle region of CHMP4

Aufreinigung: Affinity purified

Immunogen: CHMP4 B antibody was raised using the middle region of CHMP4 corresponding to a region with amino acids RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHMP4B Blocking Peptide, catalog no. 33R-8000, is also available for use as a blocking control in assays to test for specificity of this CHMP4B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHMP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHMP4B

Target: CHMP4B (Charged Multivesicular Body Protein 4B (CHMP4B))

Andere Bezeichnung: CHMP4B (CHMP4B Produkte)

Synonyme: C20orf178 antikoerper, CHMP4A antikoerper, CTPP3 antikoerper, CTRCT31 antikoerper, SNF7 antikoerper, SNF7-2 antikoerper, Shax1 antikoerper, VPS32B antikoerper, Vps32-2 antikoerper, dJ553F4.4 antikoerper, 2010012F05Rik antikoerper, C76846 antikoerper, Snf7-2 antikoerper, RGD1309846 antikoerper, RGD1565889 antikoerper, CHMP4b antikoerper, chmp4b antikoerper, chmp4b.S antikoerper, CHMP4c antikoerper, c20orf178 antikoerper, wu:fc96b02 antikoerper, zgc:55566 antikoerper, charged multivesicular body protein 4B antikoerper, charged multivesicular body protein 4Ba antikoerper, charged multivesicular body protein 4B L homeolog antikoerper, charged multivesicular body protein 4Bb antikoerper, CHMP4B antikoerper, Chmp4b antikoerper, chmp4ba antikoerper, chmp4b.L antikoerper, chmp4bb antikoerper

Hintergrund: This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts.

Molekulargewicht: 25 kDa (MW of target protein)