CHMP4B Antikörper (Middle Region)

Produktnummer ABIN633066

Dieses Anti-CHMP4B-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CHMP4B in WB. Geeignet für Human.

Kurzübersicht für CHMP4B Antikörper (Middle Region) (ABIN633066)

Target: CHMP4B (Charged Multivesicular Body Protein 4B (CHMP4B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHMP4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHMP4B Antikörper

Bindungsspezifität: Middle Region

Spezifität: CHMP4 B antibody was raised against the middle region of CHMP4

Aufreinigung: Affinity purified

Immunogen: CHMP4 B antibody was raised using the middle region of CHMP4 corresponding to a region with amino acids RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHMP4B Blocking Peptide, (ABIN5612852), is also available for use as a blocking control in assays to test for specificity of this CHMP4B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHMP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHMP4B

Target: CHMP4B (Charged Multivesicular Body Protein 4B (CHMP4B))

Andere Bezeichnung: CHMP4B

Hintergrund: This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts.

Molekulargewicht: 25 kDa (MW of target protein)