EXOC8 Antikörper (N-Term)

Produktnummer ABIN633065

Der Kaninchen Polyklonal Anti-EXOC8-Antikörper wurde für WB validiert. Er ist geeignet, EXOC8 in Proben von Human zu detektieren.

Kurzübersicht für EXOC8 Antikörper (N-Term) (ABIN633065)

Target: EXOC8 (EXO84) (Exocyst Complex Component 8 (EXO84))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EXOC8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EXOC8 Antikörper

Bindungsspezifität: N-Term

Spezifität: EXOC8 antibody was raised against the N terminal of EXOC8

Aufreinigung: Affinity purified

Immunogen: EXOC8 antibody was raised using the N terminal of EXOC8 corresponding to a region with amino acids MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EXOC8 Blocking Peptide, (ABIN5613430), is also available for use as a blocking control in assays to test for specificity of this EXOC8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EXOC8

Target: EXOC8 (EXO84) (Exocyst Complex Component 8 (EXO84))

Andere Bezeichnung: EXOC8

Hintergrund: EXOC8 is the component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane.

Molekulargewicht: 82 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism