EXOC8 Antikörper (N-Term)
Kurzübersicht für EXOC8 Antikörper (N-Term) (ABIN633065)
Target
Alle EXOC8 (EXO84) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- EXOC8 antibody was raised against the N terminal of EXOC8
-
Aufreinigung
- Affinity purified
-
Immunogen
- EXOC8 antibody was raised using the N terminal of EXOC8 corresponding to a region with amino acids MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
EXOC8 Blocking Peptide, (ABIN5613430), is also available for use as a blocking control in assays to test for specificity of this EXOC8 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC8 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- EXOC8 (EXO84) (Exocyst Complex Component 8 (EXO84))
-
Andere Bezeichnung
- EXOC8
-
Hintergrund
- EXOC8 is the component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane.
-
Molekulargewicht
- 82 kDa (MW of target protein)
-
Pathways
- Peptide Hormone Metabolism
Target
-