UGGT1 Antikörper (Middle Region)

Produktnummer ABIN633063

Produktdetails anti-UGGT1 Antikörper

Target: UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGGT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGCGL1 antibody was raised against the middle region of µgCGL1

Aufreinigung: Affinity purified

Immunogen: UGCGL1 antibody was raised using the middle region of µgCGL1 corresponding to a region with amino acids AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGCGL1 Blocking Peptide, catalog no. 33R-1061, is also available for use as a blocking control in assays to test for specificity of this µgCGL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGGT1

Target: UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))

Andere Bezeichnung: UGCGL1 (UGGT1 Produkte)

Hintergrund: UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.

Molekulargewicht: 175 kDa (MW of target protein)

Pathways: Activation of Innate immune Response