NDFIP2 Antikörper (Middle Region)

Produktnummer ABIN633059

Produktdetails anti-NDFIP2 Antikörper

Target: NDFIP2 (Nedd4 Family Interacting Protein 2 (NDFIP2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDFIP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NDFIP2 antibody was raised against the middle region of NDFIP2

Aufreinigung: Affinity purified

Immunogen: NDFIP2 antibody was raised using the middle region of NDFIP2 corresponding to a region with amino acids SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDFIP2 Blocking Peptide, catalog no. 33R-8419, is also available for use as a blocking control in assays to test for specificity of this NDFIP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDFIP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDFIP2

Target: NDFIP2 (Nedd4 Family Interacting Protein 2 (NDFIP2))

Andere Bezeichnung: NDFIP2 (NDFIP2 Produkte)

Hintergrund: NDFIP2 activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, NDFIP2 may control many cellular processes. NDFIP2 recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. NDFIP2 may modulate EGFR signaling.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity, SARS-CoV-2 Protein Interaktom