PNKP Antikörper (Middle Region)
-
- Target Alle PNKP Antikörper anzeigen
- PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PNKP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PNKP antibody was raised against the middle region of PNKP
- Aufreinigung
- Affinity purified
- Immunogen
- PNKP antibody was raised using the middle region of PNKP corresponding to a region with amino acids ALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTT
- Top Product
- Discover our top product PNKP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PNKP Blocking Peptide, catalog no. 33R-1356, is also available for use as a blocking control in assays to test for specificity of this PNKP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNKP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))
- Andere Bezeichnung
- PNKP (PNKP Produkte)
- Synonyme
- EIEE10 antikoerper, MCSZ antikoerper, PNK antikoerper, Tb06.28P18.320 antikoerper, 21.m03011 antikoerper, 1810009G08Rik antikoerper, polynucleotide kinase 3'-phosphatase antikoerper, hypothetical protein antikoerper, polynucleotide kinase 3'- phosphatase antikoerper, PNKP antikoerper, Pnkp antikoerper, Tc00.1047053507017.50 antikoerper, Tc00.1047053505807.190 antikoerper, Tb927.6.1580 antikoerper, BBOV_IV000690 antikoerper, CC1G_05202 antikoerper, PGTG_20262 antikoerper, PGTG_18987 antikoerper, pnkp.S antikoerper, pnkp antikoerper
- Hintergrund
- This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- DNA Reparatur, Nucleotide Phosphorylation
-