SULT1E1 Antikörper (Middle Region)

Produktnummer ABIN633046

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SULT1E1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für SULT1E1 Antikörper (Middle Region) (ABIN633046)

Target: SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SULT1E1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SULT1E1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SULT1 E1 antibody was raised against the middle region of SULT1 1

Aufreinigung: Affinity purified

Immunogen: SULT1 E1 antibody was raised using the middle region of SULT1 1 corresponding to a region with amino acids LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SULT1E1 Blocking Peptide, (ABIN5616455), is also available for use as a blocking control in assays to test for specificity of this SULT1E1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SULT1E1

Target: SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))

Andere Bezeichnung: SULT1E1

Hintergrund: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis