SULT1E1 Antikörper (Middle Region)
-
- Target Alle SULT1E1 Antikörper anzeigen
- SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SULT1E1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SULT1 E1 antibody was raised against the middle region of SULT1 1
- Aufreinigung
- Affinity purified
- Immunogen
- SULT1 E1 antibody was raised using the middle region of SULT1 1 corresponding to a region with amino acids LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY
- Top Product
- Discover our top product SULT1E1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SULT1E1 Blocking Peptide, catalog no. 33R-5214, is also available for use as a blocking control in assays to test for specificity of this SULT1E1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))
- Andere Bezeichnung
- SULT1E1 (SULT1E1 Produkte)
- Hintergrund
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-