FGL2 Antikörper (Middle Region)
-
- Target Alle FGL2 Antikörper anzeigen
- FGL2 (Fibrinogen-Like 2 (FGL2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FGL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FGL2 antibody was raised against the middle region of FGL2
- Aufreinigung
- Affinity purified
- Immunogen
- FGL2 antibody was raised using the middle region of FGL2 corresponding to a region with amino acids WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
- Top Product
- Discover our top product FGL2 Primärantikörper
-
anti-Fibrinogen-Like 2 (FGL2) (AA 24-123) antibody
FGL2 Reaktivität: Human WB, ELISA, IP, IHC (p) Wirt: Maus Monoclonal 6D9 unconjugated
anti-Fibrinogen-Like 2 (FGL2) (AA 338-367), (C-Term) antibodyFGL2 Reaktivität: Human WB, FACS Wirt: Kaninchen Polyclonal RB19509 unconjugated
anti-Fibrinogen-Like 2 (FGL2) (AA 24-123) antibodyFGL2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 5A10 unconjugated
anti-Fibrinogen-Like 2 (FGL2) (AA 1-439) antibodyFGL2 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Fibrinogen-Like 2 (FGL2) (AA 75-150) antibodyFGL2 Reaktivität: Maus, Ratte WB, ELISA, FACS, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Fibrinogen-Like 2 (FGL2) (AA 20-432) antibodyFGL2 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibrinogen-Like 2 (FGL2) (AA 24-439) antibodyFGL2 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibrinogen-Like 2 (FGL2) antibodyFGL2 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibrinogen-Like 2 (FGL2) (AA 24-439) antibodyFGL2 Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Fibrinogen-Like 2 (FGL2) (AA 20-432) antibodyFGL2 Reaktivität: Maus WB, IHC, IP, IF/ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FGL2 Blocking Peptide, catalog no. 33R-10030, is also available for use as a blocking control in assays to test for specificity of this FGL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FGL2 (Fibrinogen-Like 2 (FGL2))
- Andere Bezeichnung
- FGL2 (FGL2 Produkte)
- Synonyme
- FGL2 antikoerper, wu:fj83c10 antikoerper, zgc:136619 antikoerper, si:ch211-276e22.3 antikoerper, fibroleukin antikoerper, T49 antikoerper, pT49 antikoerper, AI385601 antikoerper, musfiblp antikoerper, fibrinogen like 2 antikoerper, fibrinogen like 2 L homeolog antikoerper, fibrinogen-like 2a antikoerper, fibrinogen-like 2 antikoerper, fibrinogen-like protein 2 antikoerper, FGL2 antikoerper, fgl2.L antikoerper, fgl2a antikoerper, Fgl2 antikoerper
- Hintergrund
- The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.
- Molekulargewicht
- 48 kDa (MW of target protein)
-
