CA5B Antikörper (N-Term)

Produktnummer ABIN633032

Produktdetails anti-CA5B Antikörper

Target: CA5B (Carbonic Anhydrase VB, Mitochondrial (CA5B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CA5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Carbonic Anhydrase Vb antibody (Mitochondrial) was raised against the N terminal of CA5 B

Aufreinigung: Affinity purified

Immunogen: Carbonic Anhydrase Vb antibody (Mitochondrial) was raised using the N terminal of CA5 B corresponding to a region with amino acids WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carbonic Anhydrase Vb Blocking Peptide (Mitochondrial), catalog no. 33R-9998, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase Vb antibody (Mitochondrial)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CA5B

Target: CA5B (Carbonic Anhydrase VB, Mitochondrial (CA5B))

Andere Bezeichnung: Carbonic Anhydrase Vb (CA5B Produkte)

Synonyme: CA-VB antikoerper, 7330410H16Rik antikoerper, CAVB antikoerper, Ca5b antikoerper, CarVb antikoerper, D730005F19Rik antikoerper, zgc:171653 antikoerper, CA5B antikoerper, ca5b antikoerper, carbonic anhydrase 5B antikoerper, carbonic anhydrase 5b, mitochondrial antikoerper, carbonic anhydrase Va antikoerper, carbonic anhydrase 5A antikoerper, carbonic anhydrase 5B, mitochondrial antikoerper, carbonic anhydrase VB, mitochondrial L homeolog antikoerper, CA5B antikoerper, Car5b antikoerper, Ca5b antikoerper, ca5a antikoerper, CA5A antikoerper, LOC100051095 antikoerper, ca5b.L antikoerper

Hintergrund: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VB is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. It has a wider tissue distribution than CA VA, which is restricted to the liver. The differences in tissue distribution suggest that the two mitochondrial carbonic anhydrases evolved to assume different physiologic roles.

Molekulargewicht: 33 kDa (MW of target protein)