CA5B Antikörper (N-Term)

Produktnummer ABIN633032

Der Kaninchen Polyklonal Anti-CA5B-Antikörper wurde für WB validiert. Er ist geeignet, CA5B in Proben von Human zu detektieren.

Kurzübersicht für CA5B Antikörper (N-Term) (ABIN633032)

Target: CA5B (Carbonic Anhydrase VB, Mitochondrial (CA5B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CA5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CA5B Antikörper

Bindungsspezifität: N-Term

Spezifität: Carbonic Anhydrase Vb antibody (Mitochondrial) was raised against the N terminal of CA5 B

Aufreinigung: Affinity purified

Immunogen: Carbonic Anhydrase Vb antibody (Mitochondrial) was raised using the N terminal of CA5 B corresponding to a region with amino acids WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carbonic Anhydrase Vb Blocking Peptide (Mitochondrial), (ABIN5612606), is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase Vb antibody (Mitochondrial)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CA5B

Target: CA5B (Carbonic Anhydrase VB, Mitochondrial (CA5B))

Andere Bezeichnung: Carbonic Anhydrase Vb

Hintergrund: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VB is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. It has a wider tissue distribution than CA VA, which is restricted to the liver. The differences in tissue distribution suggest that the two mitochondrial carbonic anhydrases evolved to assume different physiologic roles.

Molekulargewicht: 33 kDa (MW of target protein)