APIP Antikörper (Middle Region)

Produktnummer ABIN633024

Dieses Anti-APIP-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von APIP in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für APIP Antikörper (Middle Region) (ABIN633024)

Target: APIP (APAF1 Interacting Protein (APIP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APIP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-APIP Antikörper

Bindungsspezifität: Middle Region

Spezifität: APIP antibody was raised against the middle region of APIP

Aufreinigung: Affinity purified

Immunogen: APIP antibody was raised using the middle region of APIP corresponding to a region with amino acids GIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

APIP Blocking Peptide, (ABIN938716), is also available for use as a blocking control in assays to test for specificity of this APIP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APIP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APIP

Target: APIP (APAF1 Interacting Protein (APIP))

Andere Bezeichnung: APIP

Hintergrund: APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process