FBXO15 Antikörper (N-Term)

Produktnummer ABIN632966

Der Kaninchen Polyklonal Anti-FBXO15-Antikörper wurde für WB validiert. Er ist geeignet, FBXO15 in Proben von Human und Ratte zu detektieren.

Kurzübersicht für FBXO15 Antikörper (N-Term) (ABIN632966)

Target: FBXO15 (F-Box Protein 15 (FBXO15))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FBXO15 Antikörper

Bindungsspezifität: N-Term

Spezifität: FBXO15 antibody was raised against the N terminal of FBXO15

Aufreinigung: Affinity purified

Immunogen: FBXO15 antibody was raised using the N terminal of FBXO15 corresponding to a region with amino acids QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO15 Blocking Peptide, (ABIN5613535), is also available for use as a blocking control in assays to test for specificity of this FBXO15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO15

Target: FBXO15 (F-Box Protein 15 (FBXO15))

Andere Bezeichnung: FBXO15

Hintergrund: FBXO15 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO15, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molekulargewicht: 49 kDa (MW of target protein)