ARHGAP15 Antikörper (Middle Region)

Produktnummer ABIN632948

Der Kaninchen Polyklonal Anti-ARHGAP15-Antikörper wurde für WB validiert. Er ist geeignet, ARHGAP15 in Proben von Human zu detektieren.

Kurzübersicht für ARHGAP15 Antikörper (Middle Region) (ABIN632948)

Target: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARHGAP15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ARHGAP15 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ARHGAP15 antibody was raised against the middle region of ARHGAP15

Aufreinigung: Affinity purified

Immunogen: ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARHGAP15 Blocking Peptide, (ABIN5612146), is also available for use as a blocking control in assays to test for specificity of this ARHGAP15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARHGAP15

Target: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Andere Bezeichnung: ARHGAP15

Hintergrund: RHO GTPases regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15.

Molekulargewicht: 54 kDa (MW of target protein)