PTGR1 Antikörper (N-Term)

Produktnummer ABIN632800

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PTGR1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für PTGR1 Antikörper (N-Term) (ABIN632800)

Target: PTGR1 (Prostaglandin Reductase 1 (PTGR1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTGR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PTGR1 Antikörper

Bindungsspezifität: N-Term

Spezifität: LTB4 DH antibody was raised against the N terminal Of Ltb4 h

Aufreinigung: Affinity purified

Immunogen: LTB4 DH antibody was raised using the N terminal Of Ltb4 h corresponding to a region with amino acids VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LTB4DH Blocking Peptide, (ABIN5614604), is also available for use as a blocking control in assays to test for specificity of this LTB4DH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTB0 H antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTGR1

Target: PTGR1 (Prostaglandin Reductase 1 (PTGR1))

Andere Bezeichnung: LTB4DH

Hintergrund: LTB4DH functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. LTB4DH catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.

Molekulargewicht: 36 kDa (MW of target protein)