CCDC7 Antikörper (N-Term)

Produktnummer ABIN632784

Der Kaninchen Polyklonal anti-CCDC7 Antikörper (ABIN632784) detektiert spezifisch CCDC7 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für CCDC7 Antikörper (N-Term) (ABIN632784)

Target: CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCDC7 Antikörper

Bindungsspezifität: N-Term

Spezifität: CCDC7 antibody was raised against the N terminal of CCDC7

Aufreinigung: Affinity purified

Immunogen: CCDC7 antibody was raised using the N terminal of CCDC7 corresponding to a region with amino acids KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC7 Blocking Peptide, (ABIN939801), is also available for use as a blocking control in assays to test for specificity of this CCDC7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC7

Target: CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))

Andere Bezeichnung: CCDC7

Hintergrund: The function of CCDC7 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 56 kDa (MW of target protein)